Components installed with case types

  • Release version: Zurich
  • Updated July 31, 2025
  • 4 minutes to read
  • Summarize
    Summarized using AI
    This content was generated using new OpenAI-powered functionality. Results are provided on an as is basis and are not guaranteed to be accurate or complete.

    Summary of Components installed with case types

    The Customer Service Case Types plugin (com.snc.csmcasetypes) in ServiceNow Zurich release installs multiple components to support case management and service definitions. These components include new tables, roles, system properties, and extension points that enhance case type configuration and the case creation experience for agents and customers.

    Show full answer Show less

    Tables Installed with Case Types

    This plugin adds several tables essential for managing case types and service definitions:

    • Case Type [sncasetype]: Stores defined case types used in customer service cases.
    • Service Definition [sncasetypeselection]: Stores service definitions with additional fields like Domain Path and Playbook Record Generator.
    • Service Definition Category and Relationships: Manage categories and their relationships to service definitions.
    • Product Service Relationship: Links products to service definitions, allowing association of products with service cases.
    • Service to Service Relationship: Captures relationships between related services within service definitions.
    • Catalog Service Relationship: Links catalog items to service definitions to integrate service offerings.
    • User and Customer Criteria Tables: Store criteria to filter services available to users and customers during case creation, ensuring relevant service options.

    Roles Installed with Case Types

    The plugin provides specific roles to manage and access service definitions and their related data:

    • Service Definition Admin: Full administrative rights to create, update, delete, and view service definitions and categories.
    • Service Definition Manager: Rights to create, update, and view service definitions and categories.
    • Service Definition Viewer: Read-only access to service definitions and categories.
    • Service Definition Report Viewer: Access for viewing reports related to service definitions.
    • Service Definition All Table Viewer: View access to all service definition tables.

    System Properties Installed with Case Types

    Properties control the behavior and appearance of the case type selector screen in the Customer Service Management (CSM) Configurable Workspace:

    • sncsmcasetypes.casetypesinglefieldselect: Enables a single-select case type creation screen for agents (default: false).
    • sncsmcasetypes.servicedefinitionselect: Enables the Product Service Select screen, allowing case creation based on selected products or services (default: true). This property has precedence over the single-field select.
    • sncsmcasetypes.servicedefinitionselectcount: Defines how many products or services display in the selector screen (default: 25).
    • sncsmcasetypes.getcasetypesroles: Lists roles authorized to access the Case Type Selector and getCaseTypes API, customizable by appending roles.

    Extension Points Installed with Case Types

    The plugin includes an extension point named CSMServiceDefinitionIntegrations that allows customization of the product list shown to agents in the Product Service Select screen. Out of the box, this list filters products based on customer context, showing sold products and installed base items.

    Administrators can extend or override this behavior by creating implementations on this scripted extension point to modify the product data returned. The implementation with the lowest order number is used by the system.

    Several types of components are installed with the Customer Service Case Types plugin (com.snc.csm_case_types), including components that support the service definitions feature.

    Tables installed with case types

    The following tables are installed with the Customer Service Case Types (com.snc.csm_case_types) plugin.

    Table 1. Tables added with case types
    Table Description
    Case Type

    [sn_case_type]

    This table stores the defined case types.

    For more information, see Customer Service case types.

    Service Definition

    [sn_case_type_selection]

    This table stores the defined service definitions.
    The service definition feature adds the following fields to the Service Definition table:
    • Domain Path
    • Playbook Record Generator
    • Active
    • Number

    For more information, see Service definitions.

    Service Definition Category

    [sn_csm_case_types_service_category]

    This table stores the categories that are created for service definitions.
    Service Definition Category Relationships

    [sn_csm_case_types_service_category_rel]

    This table stores the service definitions that are associated with a service definition category.
    Product Service Relationship

    [sn_csm_case_types_product_service_rel]

    This table stores the products that are linked to a service definition.

    For more information about these relationships, see Associate a product with a service definition.

    Service to Service Relationship

    [sn_csm_case_types_service_to_service_rel]

    This table stores relationships that have been configured between services. For example, related services that have been added to a service definition.
    Catalog Service Relationship

    [sn_csm_case_types_catalog_service_rel]

    This table stores the catalog items that are linked to a service definition.

    For more information, see Configure catalog items for a service definition.

    Service Definition User Criteria

    [sn_csm_case_types_service_user_criteria]

    This table stores the user criteria that has been configured for a service definition record. The system uses this criteria to filter the services that are available to users in the service selector when creating a case. For more information, see Configure user criteria for a service definition.
    Service Definition Customer Criteria

    [sn_csm_case_types_service_customer_criteria]

    This table stores the customer criteria that has been configured for a service definition record. The system uses this criteria to filter the services that are available to customers. For more information, see Configure customer criteria for a service definition.

    Roles installed with case types

    The following service definition roles are installed with the Customer Service Case Types (com.snc.csm_case_types) plugin.

    Table 2. Roles installed with case types
    Role Description Contains roles
    Service definition admin

    [sn_csm_case_types.service_definition_admin]

    Administrator role for the Customer Service case types tables. Users with this role can view, create, update, and delete service definitions, service definition categories, and service definition category relationships.
    • sn_csm_case_types.service_definition_manager
    • sn_service_org.service_criteria_delete
    Service definition manager

    [sn_csm_case_types.service_definition_manager]

    Manager role for the Customer Service case types tables. Users with this role can view, create, and update service definitions, service definition categories, and service definition category relationships.
    • sn_csm_case_types.service_definition_report_view
    • sn_csm_case_types.service_definition_all_table_viewerr
    • sn_service_org.service_criteria_write
    • sn_service_org.service_criteria_create
    • sn_service_org.service_criteria_read
    Service definition viewer

    [sn_csm_case_types.service_definition_viewer]

    Users with this role can view service definitions, service definition categories, and service definition category relationships. sn_service_org.service_criteria_read
    Service definition report viewer

    [sn_csm_case_types.service_definition_report_view]

    Provides report view access to service definition related tables. None
    Service definition all table viewer

    [sn_csm_case_types.service_definition_all_table_viewer]

    Provides view access to the service definition tables. Users with this role can view service definitions, service definition categories, and service definition category relationships. None

    Properties installed with case types

    The following properties are added with the Customer Service Case Types plugin. These properties control the version of the case type selector screen that is displayed to agents. For more information, see Case type selector screen.

    Table 3. Properties installed with case types
    Property Description
    sn_csm_case_types.case_type_single_field_select Set this property to true to enable the case type single select feature in CSM Configurable Workspace. When enabled, an agent can use this feature to create a case of a specific type with a single selection in the case type selector screen.
    • Type: true | false
    • Default value: false
    • Location: System Property [sys_properties] table
    sn_csm_case_types.service_definition_select Set this property to true to enable the Product Service Select version of the case type selector screen. When enabled, an agent can use this screen to create a record based on the selected product or service.
    • Type: true | false
    • Default value: true
    • Location: System Property [sys_properties] table
    This property overrides the sn_csm_case_types.case_type_single_field_select property.
    • When set to true, the system displays the Product Service Select screen.
    • When set to false, the system uses the value of the sn_csm_case_types.case_type_single_field_select property.
    • If both properties are set to true, the sn_csm_case_types.service_definition_select property takes precedence.
    • If both properties are set to false, the system displays the multi-select screen.
    sn_csm_case_types.service_definition_select_count Determines the number of the products and services displayed in the Product Service Select screen.
    • Type: integer
    • Default value: 25
    • Location: System Property [sys_properties] table
    sn_csm_case_types.get_case_types_roles Stores the admin and agent roles that can access the Case Type Selector and getCaseTypes API. Roles are listed in the Value field in a comma-separated list. To add a role, append the role at the end of the list.
    • Type: string
    • Default value:

      itil,admin,sn_customerservice_agent,sn_customerservice.consumer_agent

    • Location: System Property [sys_properties] table

    Extension points installed with case types

    Extension points enable you to extend the functionality of an application and integrate customizations without altering the application code. Extension points are stored in the Extension Point [sys_extension_point] table.

    The CSMServiceDefinitionIntegrations extension point returns a list of products that is available to agents in the Product field on Product Service Select version of the case type selector screen. Out of box, this list is based on customer context and displays the sold products and install base items owned by the customer.

    To access this extension point, navigate to All > System Extension Points > Scripted Extension Points and select CSMServiceDefinitionIntegrations.

    To modify this extension point:
    1. Select the Create implementation related link on the extension point record.
    2. Modify the Script field and add an API to return product information.
    3. Select Update.
      The system adds the implementation to the Implementations related list on the extension point record.
      Note:
      The implementation with the lowest Order number is used to return the list of products.